RPSBLAST alignment of GI: 254780710 and MMDB domain: 1ym5_A_

>1ym5_A (A:) YHI9, hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region; PHZF enzyme superfamily, double hot-DOG, structural genomics; 2.05A {Saccharomyces cerevisiae}Length = 300
 Score =  101 bits (251), Expect = 1e-22
 Identities = 43/294 (14%), Positives = 89/294 (30%), Gaps = 32/294 (10%)

Query: 8   FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFIRII 67
           F +   +GN + VI+     +N  S         + T+  +   +    D   D  +R I
Sbjct: 13  FTEKPFMGNPVAVINFLEIDENEVSQEELQAI-ANWTNLSETTFLFKPSDKKYDYKLR-I 70

Query: 68  NCDGSEVQSCGNGMRCVVRFLTSRM---KRKSFTFETIRGILVAKENRDGSISVDMGEPI 124
               SE+   G+      +            S   E   G +    N +G IS       
Sbjct: 71  FTPRSELPFAGHPTIGSCKAFLEFTKNTTATSLVQECKIGAVPITIN-EGLISFKAPMAD 129

Query: 125 LDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVED----DLYHYDL 180
            +     +   ++K    +F   P          ++  G    +  VED       + + 
Sbjct: 130 YESISSEMIADYEKAIGLKFIKPPA---------LLHTGPEWIVALVEDAETCFNANPNF 180

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGL--TAACGSAACASVVASGC 238
           A   +   ++      +           S ++R +   + +     CGS + A       
Sbjct: 181 AMLAHQTKQNDHVGIILAGPKKEAAIKNSYEMRAFAPVINVYEDPVCGSGSVALARYLQE 240

Query: 239 LHKTNRAVSVKM-------LGGGLLIEWHDNN----HVFMTGEAKKEWEGKLDI 281
           ++K  +   + +         G +L             ++ G A    +GK+ +
Sbjct: 241 VYKFEKTTDITISEGGRLKRNGLMLASIKKEADNSTSYYIAGHATTVIDGKIKV 294