RPSBLAST alignment of GI: 254780710 and MMDB domain: 2otn_A_1-96_294-308

>2otn_A (A:1-96,A:294-308) Diaminopimelate epimerase; DAP, lysine metabolism, X-RAY, lanthionine, isomeras; 2.40A {Bacillus anthracis str}Length = 111
 Score = 58.4 bits (141), Expect = 1e-09
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 6  VDFAKMEGIGNKILVIDMRG--CHDNITSDAINALSTDDNT--HFDQIMLIHDFQDASVD 61
            F KM G+GN  + ++M      +   +     +S + NT    D ++LI     A   
Sbjct: 24 FSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVS-NINTGIGADGMILICPSDVA--P 80

Query: 62 AFIRIINCDGSEVQSCG 78
            +R+ N DGSE +SC 
Sbjct: 81 VKMRMFNNDGSEGKSCA 97