RPSBLAST alignment of GI: 254780710 and protein with PDBid: 1u0k

>1u0k_A Gene product PA4716; sctructural genomics, MCSG, protein structure initiative, structural genomics, PSI; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.21.1.2 d.21.1.2 Length = 288
 Score = 76.2 bits (186), Expect = 9e-15
 Identities = 42/290 (14%), Positives = 80/290 (27%), Gaps = 23/290 (7%)

Query: 6   VD-FAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASVDAFI 64
           +D FA+    GN + V D       +   A+ A + +      + + +    D    AF 
Sbjct: 10  LDVFAERPLTGNGLAVFDD---ASALDDAAMQAWTRELR--QFESIFLLPGDDP--RAFR 62

Query: 65  RIINCDGSEVQSCGNGMRCVVRFLTSRMK--RKSFTFETIRGILVAKENRDGSISVDMGE 122
             I     E+   G+ +      L        +      +    VA  +           
Sbjct: 63  ARIFTLEEELPFAGHPLLGAAALLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEM 122

Query: 123 PILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDLAS 182
                +      +              N L    P VVS G P+ +  V  +        
Sbjct: 123 DQGRAEFGATPDAGTCRWFAEAFSLSANDLSGHPPRVVSTGLPYLLLPVTAEA-----LG 177

Query: 183 FGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWER-GVGLTAACGSAACASVVASGCLHK 241
               +       + +  +   +  ++  + RTW+  G+    A GSAA            
Sbjct: 178 RARQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAYLVEYGL 237

Query: 242 TNRAVSVKML-------GGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTG 284
             R     +           L ++   +  V + G  +     +L    G
Sbjct: 238 AARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAELLTSAG 287