RPSBLAST alignment of GI: 254780710 and protein with PDBid: 1xub

>1xub_A Phenazine biosynthesis protein PHZF; biosynthetic protein; 1.30A {Pseudomonas fluorescens} SCOP: d.21.1.2 d.21.1.2 PDB: 1u1w_A* 1u1v_A* 1u1x_A* 1xua_A* 1t6k_A Length = 298
 Score = 57.7 bits (138), Expect = 3e-09
 Identities = 32/232 (13%), Positives = 57/232 (24%), Gaps = 21/232 (9%)

Query: 61  DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM 120
           DA IRI      E+   G  +      L +         ET  G +  +  R     +  
Sbjct: 77  DALIRIFTPVN-ELPFAGAPLLGTAIALGAHTDNHRLYLETQMGTIAFELERQNGSVIAA 135

Query: 121 GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL 180
                      L R  + +                   +   G  H    +        L
Sbjct: 136 SMDQPIPTWTALGRDAELLKALGISD------STFPIEIYHNGPRHVFVGLPS---IDAL 186

Query: 181 ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH 240
           ++          F +      A         + +   GV   AA GSAA    +      
Sbjct: 187 SALHPDHRALSNFHDMAINCFAGAGRRWRSRMFSPAYGVVEDAATGSAAGPLAIHLARHG 246

Query: 241 KTNRAVSVKML-------GGGLLIEWHDNN----HVFMTGEAKKEWEGKLDI 281
           +      V++L          +  +          V ++G       G + +
Sbjct: 247 QIEFGQPVEILQGVEIGRPSLMFAKAEGRAEQLTRVEVSGNGVTFGRGTIVL 298