HHsearch alignment for GI: 254780711 and conserved domain: cd02042

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.
Probab=97.93  E-value=1.8e-05  Score=62.04  Aligned_cols=47  Identities=36%  Similarity=0.536  Sum_probs=41.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             43334688999999998614895078205422100477999985103474222332103689999999999741588699
Q gi|254780711|r  109 QGSGKTTTTAKIAYHLKTLKKKKILMASLDVHRPAAQEQLRYLGEQIQVDTLEVIPEQSPEKIAIRATQSARDGGYDAVI  188 (461)
Q Consensus       109 ~GsGKTTT~aKLA~~~~~~~~~kV~lv~~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~~dp~~i~~~a~~~a~~~~~D~ii  188 (461)
T Consensus         9 GGvGKtt~~~~la~~~a~-~g~~vl~iD~DpQ-------------------------------------------yD~ii   44 (104)
T cd02042           9 GGVGKTTTAVNLAAALAR-RGKRVLLIDLDPQ-------------------------------------------YDYII   44 (104)
T ss_pred             CCCCHHHHHHHHHHHHHH-CCCEEEEEECCCC-------------------------------------------CCEEE
T ss_conf             987689999999999997-7992999977988-------------------------------------------88899


Q ss_pred             EECCCCCCCHH
Q ss_conf             83344222112
Q gi|254780711|r  189 LDTAGRNHIND  199 (461)
Q Consensus       189 iDTaGR~~~d~  199 (461)
T Consensus        45 IDtpp~~~~~~   55 (104)
T cd02042          45 IDTPPSLGLLT   55 (104)
T ss_pred             EECCCCCCHHH
T ss_conf             97949998999