>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt

Probab=95.18  E-value=0.12  Score=32.67  Aligned_cols=31  Identities=16%  Similarity=0.123  Sum_probs=22.2

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             8418996234433346889999999986148
Q gi|254780711|r   99 SPLVIMLVGLQGSGKTTTTAKIAYHLKTLKK  129 (461)
Q Consensus        99 ~p~vIllvGl~GsGKTTT~aKLA~~~~~~~~  129 (461)
T Consensus        26 ~Ge~v~i~G~sGsGKSTLl~~l~Gl~~~~~G   56 (166)
T cd03223          26 PGDRLLITGPSGTGKSSLFRALAGLWPWGSG   56 (166)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHCCCCCCCCC
T ss_conf             9999999958999889999998698769986