BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein [Candidatus Liberibacter asiaticus str. psy62] (190 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780713|ref|YP_003065126.1| 16S rRNA-processing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 190 Score = 393 bits (1010), Expect = e-112, Method: Compositional matrix adjust. Identities = 190/190 (100%), Positives = 190/190 (100%) Query: 1 MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60 MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF Sbjct: 1 MVKLDKLVLMATIGTTHGLNGEVYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF 60 Query: 61 IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120 IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC Sbjct: 61 IATFSGIDNIHSASELRDLKLYAKRQDFKDEELEEDEFFNTDLEEMETFDRQGKYWGQVC 120 Query: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD Sbjct: 121 GVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAAGLNNTTMKNPQYD 180 Query: 181 CPLDSAGKKS 190 CPLDSAGKKS Sbjct: 181 CPLDSAGKKS 190 >gi|254780841|ref|YP_003065254.1| phosphatidylcholine synthase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 24.6 bits (52), Expect = 1.2, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 118 QVCGVYNFGAGSILEIKNTMEK 139 VCG+Y + G+IL+I + K Sbjct: 221 SVCGIYLYSIGAILQIFPNLGK 242 >gi|254780386|ref|YP_003064799.1| Type I secretion membrane fusion protein, HlyD [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Score = 23.5 bits (49), Expect = 2.3, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 105 EMETFDRQGKYWGQVCGVYNFGAGSI 130 E + D GKY V+N+G S+ Sbjct: 135 EEQLLDFLGKYHSTCSKVFNYGISSV 160 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 23.5 bits (49), Expect = 2.7, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 23 VYIDSYANNPIDLNRYVLYSNDNRELRILKMYRKNKRF-IATFS 65 +Y+DS NN N V N +R+ +L +YR + ++TFS Sbjct: 347 LYVDSVNNNAYIRNTLVTDKNKDRKDALLDIYRVMRPGDVSTFS 390 >gi|254780145|ref|YP_003064558.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus str. psy62] Length = 172 Score = 23.1 bits (48), Expect = 3.2, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 28 YANNPIDLNRY-VLYSNDNRELRIL 51 Y+++P+ + V +SNDN E R+L Sbjct: 82 YSDSPVIAPKISVSFSNDNNEFRVL 106 >gi|254780821|ref|YP_003065234.1| FolC bifunctional protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 21.9 bits (45), Expect = 6.5, Method: Compositional matrix adjust. Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Query: 120 CGVYNFGAGSILEIKNTMEKTFLIPFTKFAVLEVNLQENKILIDPIAA 167 C + G G L+ N +EK + T ++L KIL + ++A Sbjct: 122 CAIIEVGLGGSLDATNIIEKVAVSVIT-----SISLDHEKILGNTVSA 164 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.137 0.392 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 125,964 Number of Sequences: 1233 Number of extensions: 5375 Number of successful extensions: 17 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 10 length of query: 190 length of database: 328,796 effective HSP length: 69 effective length of query: 121 effective length of database: 243,719 effective search space: 29489999 effective search space used: 29489999 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 36 (18.5 bits)