RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780715|ref|YP_003065128.1| 50S ribosomal protein L19 [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >d2gycn1 b.34.5.6 (N:1-114) Ribosomal protein L19 {Escherichia coli [TaxId: 562]} Length = 114 Score = 134 bits (338), Expect = 3e-33 Identities = 62/115 (53%), Positives = 83/115 (72%), Gaps = 5/115 (4%) Query: 2 NIIDELDHEEMVRIESKRSLPKFSPGDTLCVKTIITEGDKSRIQAYEGVCIARSGRGINK 61 NII +L+ E+M K+ +P F PGDT+ VK + EG K R+QA+EGV IA RG++ Sbjct: 2 NIIKQLEQEQM-----KQDVPSFRPGDTVEVKVWVVEGSKKRLQAFEGVVIAIRNRGLHS 56 Query: 62 NFTVRKISYGEGMNRLFPLYSPMIQDITVIRRGKVRRSKLYYLQDLRGKAARIKE 116 FTVRKIS GEG+ R+F +SP++ I+V RRG VR++KLYYL++ GKAARIKE Sbjct: 57 AFTVRKISNGEGVERVFQTHSPVVDSISVKRRGAVRKAKLYYLRERTGKAARIKE 111 >d2j01t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]} Length = 138 Score = 125 bits (314), Expect = 2e-30 Identities = 51/138 (36%), Positives = 83/138 (60%), Gaps = 5/138 (3%) Query: 1 MNIIDELDHEEMVRIESKRSLPKFSPGDTLCVKTIITEGDKSRIQAYEGVCIARSGRGIN 60 +I ++ + + LP+F PGDT+ V + EG+++RIQ +EG+ I G N Sbjct: 4 GALIKLVESRYV-----RTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFN 58 Query: 61 KNFTVRKISYGEGMNRLFPLYSPMIQDITVIRRGKVRRSKLYYLQDLRGKAARIKENTGK 120 FTVRK+SYG G+ R+FPL+SP+IQ I +++RG+ RR+KLY++++L + R K + Sbjct: 59 TTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLYFIRNLSDREIRRKLRADR 118 Query: 121 RAKALNEEVRRAALPEKE 138 + + RAA E + Sbjct: 119 KRIDQDRAAERAAKEEAQ 136 >d2zjrm1 b.34.5.6 (M:2-109) Ribosomal protein L19 {Deinococcus radiodurans [TaxId: 1299]} Length = 108 Score = 116 bits (293), Expect = 7e-28 Identities = 50/106 (47%), Positives = 74/106 (69%), Gaps = 6/106 (5%) Query: 1 MNIIDELDHEEMVRIESKRSLPKFSPGDTLCVKTIITEGDKSRIQAYEGVCIARSGRGIN 60 ++ ++ + R LP F PGDT+ V T + EG+++R QA+EGV IA +G G Sbjct: 9 GELLRGIEQDHT------RQLPDFRPGDTVRVDTKVREGNRTRSQAFEGVVIAINGSGSR 62 Query: 61 KNFTVRKISYGEGMNRLFPLYSPMIQDITVIRRGKVRRSKLYYLQD 106 K+FTVRKIS+GEG+ R+FP SP++ +T++ RGKVRR+KLYYL++ Sbjct: 63 KSFTVRKISFGEGVERVFPFASPLVNQVTIVERGKVRRAKLYYLRE 108 >d2qdyb1 b.34.4.4 (B:1-211) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]} Length = 211 Score = 25.7 bits (56), Expect = 1.4 Identities = 11/71 (15%), Positives = 20/71 (28%), Gaps = 10/71 (14%) Query: 17 SKRSLPKFSPGDTLCVKTIITEGDKSRIQAY----EG-VCIARSGRGINKNFTVRKISYG 71 + F G + V+ G R+ AY G + + + + +G Sbjct: 116 APVETTTFEVGQRVRVRDEYVPG-HIRMPAYCRGRVGTISHRTTEKWPFPDAI----GHG 170 Query: 72 EGMNRLFPLYS 82 P Y Sbjct: 171 RNDAGEEPTYH 181 >d1ugpb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]} Length = 226 Score = 25.7 bits (56), Expect = 1.4 Identities = 11/39 (28%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Query: 22 PKFSPGDTLCVKTIITEGDKSRIQAY----EGVCIARSG 56 PKF GD + T +G +R Y G + G Sbjct: 137 PKFKEGDVVRFSTASPKG-HARRARYVRGKTGTVVKHHG 174 >d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Score = 24.7 bits (52), Expect = 3.3 Identities = 11/43 (25%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Query: 90 VIRRGKVRRSKLYYLQDLRGKAARIKENTGKRAKALNEEVRRA 132 ++RR +V R ++ GK R + K L E R Sbjct: 408 LVRREEVARVVKGLMEGEEGKGVR------NKMKELKEAACRV 444 >d1v29b_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Bacillus smithii [TaxId: 1479]} Length = 229 Score = 24.5 bits (53), Expect = 3.6 Identities = 10/39 (25%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Query: 22 PKFSPGDTLCVKTIITEGDKSRIQAY----EGVCIARSG 56 P+F G+ + + I G +R Y GV G Sbjct: 140 PRFEVGERIKTRNIHPTG-HTRFPRYVRDKYGVIEEVYG 177 >d1l2pa_ f.23.21.1 (A:) F1F0 ATP synthase subunit B, membrane domain {Escherichia coli [TaxId: 562]} Length = 61 Score = 23.8 bits (52), Expect = 6.0 Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 104 LQDLRGKAARIKENTGKRAKALNEEVRRAALPEKE 138 L+ + +A I E KR + +E + A E+ Sbjct: 4 LKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERT 38 >d1unaa_ d.85.1.1 (A:) GA coat protein {Bacteriophage GA [TaxId: 12018]} Length = 129 Score = 23.5 bits (50), Expect = 6.4 Identities = 7/25 (28%), Positives = 12/25 (48%) Query: 42 SRIQAYEGVCIARSGRGINKNFTVR 66 SR QAY R+ + +T++ Sbjct: 36 SRSQAYRVTASYRASGADKRKYTIK 60 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.136 0.377 Gapped Lambda K H 0.267 0.0654 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 524,075 Number of extensions: 23483 Number of successful extensions: 43 Number of sequences better than 10.0: 1 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 10 Length of query: 141 Length of database: 2,407,596 Length adjustment: 77 Effective length of query: 64 Effective length of database: 1,350,386 Effective search space: 86424704 Effective search space used: 86424704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (22.4 bits)