HHsearch alignment for GI: 254780716 and conserved domain: COG0373

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism].
Probab=97.93  E-value=0.00018  Score=52.47  Aligned_cols=72  Identities=21%  Similarity=0.416  Sum_probs=55.6

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             880569815711168899999789-859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
T Consensus       178 ~~~vlvIGAGem~~lva~~L~~~g~~~i~IaNRT~erA~~La~~~~------~~~~~l~el~~~l~~~DvVissTsa~~  250 (414)
T COG0373         178 DKKVLVIGAGEMGELVAKHLAEKGVKKITIANRTLERAEELAKKLG------AEAVALEELLEALAEADVVISSTSAPH  250 (414)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHC------CEEECHHHHHHHHHHCCEEEEECCCCC
T ss_conf             6769998651899999999985898779997587899999999838------702218778876520799999069985