HHsearch alignment for GI: 254780716 and conserved domain: COG1023

>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism].
Probab=100.00  E-value=0  Score=561.48  Aligned_cols=274  Identities=38%  Similarity=0.644  Sum_probs=256.0

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             05698157111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
T Consensus         2 ~iGmiGLGrMG~n~v~rl~~~ghdvV~yD~n~~av~~~~~~g------a~~a~sl~el~~~L~~pr~vWlMvPag~it~~   75 (300)
T COG1023           2 QIGMIGLGRMGANLVRRLLDGGHDVVGYDVNQTAVEELKDEG------ATGAASLDELVAKLSAPRIVWLMVPAGDITDA   75 (300)
T ss_pred             CCEEECCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCC------CCCCCCHHHHHHHCCCCCEEEEECCCCCCHHH
T ss_conf             011540005269999999838972899738889999998657------75436799999746987479997337773689


Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCC
Q ss_conf             99999720789989996798657899999999984799430675467600035684378845489998889999987501
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK  164 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~iaak  164 (475)
T Consensus        76 vi~~la~~L~~GDivIDGGNS~y~Ds~rr~~~l~~kgi~flD~GTSGG~~G~~~G~~lMiGG~~~a~~~~~pif~~lA~g  155 (300)
T COG1023          76 VIDDLAPLLSAGDIVIDGGNSNYKDSLRRAKLLAEKGIHFLDVGTSGGVWGAERGYCLMIGGDEEAVERLEPIFKALAPG  155 (300)
T ss_pred             HHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHCCCEEEECCCHHHHHHHHHHHHHHCCC
T ss_conf             99998853678888987886325778999998876597178346777722553572388538689999988999862768


Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHCCCCC-CCHHHHHHHHHHHHH
Q ss_conf             56786189856987467898877678788899989999999964-2899789999998606884-430799999999974
Q gi|254780716|r  165 YQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDS-LNKNPLEISHLFSKWDTGK-LSSYLIKITAEILSS  242 (475)
Q Consensus       165 ~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~-~~~~~~~i~~vf~~w~~~~-~~syLl~i~~~il~~  242 (475)
T Consensus       156 e---~Gyl~~Gp~GsGHfvKMVHNGIEYGmM~a~aEGfelL~~s~fD~D~~~VA~v---W~hGSVIrSWLldLt~~Af~~  229 (300)
T COG1023         156 E---DGYLYCGPSGSGHFVKMVHNGIEYGMMQAIAEGFELLKNSPFDYDLEAVAEV---WNHGSVIRSWLLDLTAEAFKK  229 (300)
T ss_pred             C---CCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH---HHCCCHHHHHHHHHHHHHHHH
T ss_conf             6---7630016887623289985108999999999899998718888777999999---827645999999999999854


Q ss_pred             CCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             056799952001023336587167789887751788851467778887750057
Q gi|254780716|r  243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD  296 (475)
Q Consensus       243 k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~  296 (475)
T Consensus       230 d------~~L~q~~g~v~dSGEGrWTv~~aldlgvpaPVia~al~~Rf~S~~~d  277 (300)
T COG1023         230 D------PDLDQISGRVSDSGEGRWTVEEALDLGVPAPVIALALMMRFRSRQDD  277 (300)
T ss_pred             C------CCHHHHCCEECCCCCCEEEHHHHHHCCCCCHHHHHHHHHHHHCCCHH
T ss_conf             8------88777617634588750666877763898159999999997503224