HHsearch alignment for GI: 254780716 and conserved domain: COG1052

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only].
Probab=98.47  E-value=3.8e-06  Score=64.89  Aligned_cols=113  Identities=19%  Similarity=0.279  Sum_probs=89.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
T Consensus       147 ktvGIiG~GrIG~avA~r~~~Fgm~v~y~~~~~~--~~~~~~~-----~~~y~-~l~ell~~sD---ii~l~~Plt~~T~  215 (324)
T COG1052         147 KTLGIIGLGRIGQAVARRLKGFGMKVLYYDRSPN--PEAEKEL-----GARYV-DLDELLAESD---IISLHCPLTPETR  215 (324)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEECCCCC--HHHHHHC-----CCEEC-CHHHHHHHCC---EEEEECCCCHHHH
T ss_conf             8889978488999999987217968998668874--5557405-----86041-6899997699---9999779983766


Q ss_pred             HHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             999-99972078998999679865789999999998479943067
Q gi|254780716|r   84 QLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        84 ~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
T Consensus       216 hLin~~~l~~mk~ga~lVNtaRG~~VDe~ALi~AL~~g~i~gagl  260 (324)
T COG1052         216 HLINAEELAKMKPGAILVNTARGGLVDEQALIDALKSGKIAGAGL  260 (324)
T ss_pred             HHCCHHHHHHCCCCEEEEECCCCCEECHHHHHHHHHCCCCCEEEE
T ss_conf             532999997568976999648742165999999998097422670