HHsearch alignment for GI: 254780716 and conserved domain: COG2242

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism].
Probab=93.28  E-value=0.73  Score=25.92  Aligned_cols=117  Identities=15%  Similarity=0.228  Sum_probs=78.3

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC-CCCEE--CCCHHHHHHHCCCCCEEEEECCCHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112-78403--2898999860577889999769906999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLS-QKVIV--TKNLEQMVEAVCKPRKILMMVTDGDPVDQLI   86 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~-~~~~~--~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi   86 (475)
T Consensus        44 GtGsi~iE~a--~~~p~~~v~AIe~~~~a~~~~~~N~~~fg~~n~~vv~g~Ap~-~L~~~~~~daiFIG--Gg~~i~~il  118 (187)
T COG2242          44 GTGSITIEWA--LAGPSGRVIAIERDEEALELIERNAARFGVDNLEVVEGDAPE-ALPDLPSPDAIFIG--GGGNIEEIL  118 (187)
T ss_pred             CCCHHHHHHH--HHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCHH-HHCCCCCCCEEEEC--CCCCHHHHH
T ss_conf             8668999999--739885599992588899999999998499967999546457-63699999999987--987778999


Q ss_pred             HHHHHCCCCC-CEEEECCCCCHHHHHHHHHHHHHCCC-CEECCCCCCCC
Q ss_conf             9997207899-89996798657899999999984799-43067546760
Q gi|254780716|r   87 DKLKPLLSPE-DILLDGGNSHFCDTQIRSLQLSEKGI-YFIGIGVSGGV  133 (475)
Q Consensus        87 ~~l~~~l~~g-~iiID~sts~~~~t~~~~~~l~~kgi-~fid~pVSGG~  133 (475)
T Consensus       119 e~~~~~l~~ggrlV~nait--lE~~~~a~~~~~~~g~~ei~~v~is~~~  165 (187)
T COG2242         119 EAAWERLKPGGRLVANAIT--LETLAKALEALEQLGGREIVQVQISRGK  165 (187)
T ss_pred             HHHHHHCCCCCEEEEEEEC--HHHHHHHHHHHHHCCCCEEEEEEEECCE
T ss_conf             9999971868769998600--8889999999997298569999842352