HHsearch alignment for GI: 254780716 and conserved domain: COG4091

>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism].
Probab=97.23  E-value=0.018  Score=37.77  Aligned_cols=118  Identities=17%  Similarity=0.275  Sum_probs=74.7

Q ss_pred             EEEEEECCHHHHHHHHHHHH-CCCEE-EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698157111688999997-89859-99739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILD-KGFRL-AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~-~G~~V-~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
T Consensus        19 RVGlIGAG~mG~~ivtQi~~m~Gm~vvaisd~~~~~ak~A~~~ag~~~~~~~e~~~~s~~a~Ai~aGKi~vT---~D--~   93 (438)
T COG4091          19 RVGLIGAGEMGTGIVTQIASMPGMEVVAISDRNLDAAKRAYDRAGGPKIEAVEADDASKMADAIEAGKIAVT---DD--A   93 (438)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCEEEE---CC--H
T ss_conf             998754541106799987506883699984246427889998735872000011116678899862867982---65--3


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHH--HHHHHCCCCEE--CCCCCCCC
Q ss_conf             99999997207899899967986578999999--99984799430--67546760
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRS--LQLSEKGIYFI--GIGVSGGV  133 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~--~~l~~kgi~fi--d~pVSGG~  133 (475)
T Consensus        94 ~-----~i~~~~~IdvIIdAT-G~p~vGA~~~l~Ai~h~KHlVMmNVEaDvtIGp  142 (438)
T COG4091          94 E-----LIIANDLIDVIIDAT-GVPEVGAKIALEAILHGKHLVMMNVEADVTIGP  142 (438)
T ss_pred             H-----HHHCCCCCEEEEECC-CCCCHHHHHHHHHHHCCCEEEEEEEEECEEECH
T ss_conf             5-----432388604999767-885301475799985677289997540325348