HHsearch alignment for GI: 254780716 and conserved domain: COG5495

>COG5495 Uncharacterized conserved protein [Function unknown].
Probab=96.31  E-value=0.11  Score=31.83  Aligned_cols=181  Identities=14%  Similarity=0.177  Sum_probs=92.0

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEE-EEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             805698157111688999997898599-9739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLA-VYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~-vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
T Consensus        11 ~~v~~igtGrl~ra~~~ra~h~~~~cs~i~srS~~~a~~LaE~~~---------a~p~d~~~~ael~~~vfv~vpd~-~~   80 (289)
T COG5495          11 VVVGIVGTGRLGRAALLRADHVVVACSAISSRSRDRAQNLAETYV---------APPLDVAKSAELLLLVFVDVPDA-LY   80 (289)
T ss_pred             EEEEEEECCHHHHHHHHHHHHHHEEEHHHHHCCHHHHHHHHHHCC---------CCCCCHHHCHHHHCEEEECCCHH-HH
T ss_conf             588876044278999987400321211343217899862044217---------99510120734515478626088-88


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCE----ECCCCCCCCCCCC--CCCEEEE-ECCHHHHHHHH
Q ss_conf             999999972078998999679865789999999998479943----0675467600035--6843788-45489998889
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF----IGIGVSGGVKGAR--SGASLMV-GGNEKAYNRVE  155 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~f----id~pVSGG~~gA~--~G~slMv-GG~~~~~~~~~  155 (475)
T Consensus        81 ~~vaa~--~~~rpg~iv~HcSga~~~---~il~~~gr~g~~~asiHP~f~Fsgl~edl~rl~d~~~~i~eaD~~g~ai~~  155 (289)
T COG5495          81 SGVAAT--SLNRPGTIVAHCSGANGS---GILAPLGRQGCIPASIHPAFSFSGLDEDLSRLKDTIFGITEADDVGYAIVQ  155 (289)
T ss_pred             HHHHHH--CCCCCCEEEEECCCCCCH---HHHHHHHHCCCCCCEECCCHHCCCCHHHHHHCCCCEEEEECCCCCCCHHHH
T ss_conf             888876--046898389974688740---454254215875300052110368888998654347865305655528999


Q ss_pred             HHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHC
Q ss_conf             999987501567861898569874678988776787888---999899999999642
Q gi|254780716|r  156 NILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYAN---MQLIADIYGILRDSL  209 (475)
Q Consensus       156 piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~---mq~iaE~~~~l~~~~  209 (475)
T Consensus       156 ~la~emg----g~~f~V---~~~~---r~lYHaaa~~asnf~v~~l~~a~~i~~aag  202 (289)
T COG5495         156 SLALEMG----GEPFCV---REEA---RILYHAAAVHASNFIVTVLADALEIYRAAG  202 (289)
T ss_pred             HHHHHHC----CCCEEE---CHHH---HHHHHHHHHHHHCCHHHHHHHHHHHHHHHC
T ss_conf             9999838----984452---5567---899887777641019999998999999845