HHsearch alignment for GI: 254780716 and conserved domain: KOG1201

>KOG1201 consensus.
Probab=92.59  E-value=0.9  Score=25.23  Aligned_cols=39  Identities=23%  Similarity=0.467  Sum_probs=29.0

Q ss_pred             EEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC
Q ss_conf             98157-1116889999978985999739989999999712
Q gi|254780716|r    8 IIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKI   46 (475)
Q Consensus         8 iIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~   46 (475)
T Consensus        43 ITGgg~GlGr~ialefa~rg~~~vl~Din~~~~~etv~~~   82 (300)
T KOG1201          43 ITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEI   82 (300)
T ss_pred             EECCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHH
T ss_conf             9689860789999999970784899955651239999999