HHsearch alignment for GI: 254780716 and conserved domain: KOG2304

>KOG2304 consensus.
Probab=97.31  E-value=0.0036  Score=42.94  Aligned_cols=198  Identities=17%  Similarity=0.241  Sum_probs=103.4

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC----CC--CCCEECCCHHHHHHH-CCC---CCEE
Q ss_conf             8805698157111688999997898599973998999999971221----12--784032898999860-577---8899
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG----LS--QKVIVTKNLEQMVEA-VCK---PRKI   72 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~----~~--~~~~~~~s~~e~v~~-l~~---pr~I   72 (475)
T Consensus        11 ~~~V~ivGaG~MGSGIAQv~a~sg~~V~l~d~~~~aL~~A~~~I~~sl~rvakKk~~~~~~~~~e~v~~~l~ri~~~tnv   90 (298)
T KOG2304          11 IKNVAIVGAGQMGSGIAQVAATSGLNVWLVDANEDALSRATKAISSSLKRVAKKKKADDPVALEEFVDDTLDRIKTSTNV   90 (298)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCH
T ss_conf             66247875664320399998851994698547778999999999999999986213677156788999999999871777


Q ss_pred             EEECC-CHHHHHHHHH------HHH---HCCCCCCEEEECCCCCHHHHHHHHH---HHHHCCCCEECC-CCCCCCCCCCC
Q ss_conf             99769-9069999999------997---2078998999679865789999999---998479943067-54676000356
Q gi|254780716|r   73 LMMVT-DGDPVDQLID------KLK---PLLSPEDILLDGGNSHFCDTQIRSL---QLSEKGIYFIGI-GVSGGVKGARS  138 (475)
Q Consensus        73 il~vp-~g~~v~~vi~------~l~---~~l~~g~iiID~sts~~~~t~~~~~---~l~~kgi~fid~-pVSGG~~gA~~  138 (475)
T Consensus        91 ~~~v~dadliiEAivEn~diK~~lF~~l~~~ak~~~il~tNTSSl~lt~ia~~~~~~srf~GlHFfNPvPvMKLvEVir~  170 (298)
T KOG2304          91 SDAVSDADLIIEAIVENLDIKRKLFKDLDKIAKSSTILATNTSSLSLTDIASATQRPSRFAGLHFFNPVPVMKLVEVIRT  170 (298)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCEEHHHHHHHCCCHHHHCEEECCCCCHHHHHHHHHCC
T ss_conf             77642367999999874778999999998446656288625652459987763258345011113587106778666447


Q ss_pred             CCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             84378845489998889999987501567861898569874678988776787888999899999999642899789999
Q gi|254780716|r  139 GASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISH  218 (475)
Q Consensus       139 G~slMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~  218 (475)
T Consensus       171 ~~-----TS~eTf~~l~~f~k~~gKtt-------VackDtpG----FIVNRl---LiPyl~ea~r~yerG-dAskeDIDt  230 (298)
T KOG2304         171 DD-----TSDETFNALVDFGKAVGKTT-------VACKDTPG----FIVNRL---LIPYLMEAIRMYERG-DASKEDIDT  230 (298)
T ss_pred             CC-----CCHHHHHHHHHHHHHHCCCC-------EEECCCCC----HHHHHH---HHHHHHHHHHHHHHC-CCCHHHHHH
T ss_conf             88-----88899999999999857770-------32058874----114577---899999999999816-770766889


Q ss_pred             HH
Q ss_conf             99
Q gi|254780716|r  219 LF  220 (475)
Q Consensus       219 vf  220 (475)
T Consensus       231 aM  232 (298)
T KOG2304         231 AM  232 (298)
T ss_pred             HH
T ss_conf             98