HHsearch alignment for GI: 254780716 and conserved domain: KOG2711

>KOG2711 consensus.
Probab=96.55  E-value=0.029  Score=36.19  Aligned_cols=98  Identities=16%  Similarity=0.264  Sum_probs=66.3

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHC--CC-----EEEEEECC------HHHHHHHHHH---------CCCCCCCCEECCCH
Q ss_conf             988056981571116889999978--98-----59997399------8999999971---------22112784032898
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDK--GF-----RLAVYNKD------FELTDVFIKK---------ISGLSQKVIVTKNL   59 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~--G~-----~V~vydr~------~~~~~~l~~~---------~~~~~~~~~~~~s~   59 (475)
T Consensus        20 ~~~kV~ivGsGnWGsaiaki~~~n~~~~~~f~~~Vrmwv~ee~i~~~~~~L~eiIN~~heN~KYlpg~~lP~NvvAv~dl   99 (372)
T KOG2711          20 DPLKVCIVGSGNWGSAIAKIVGENVKEFPIFDPQVRMWVFEEEINGEAEKLTEIINSRHENVKYLPGIKLPENVVAVPDL   99 (372)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEECCHH
T ss_conf             75379998168089999999865254055667303677750133770578998751556342336786599776765239


Q ss_pred             HHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             99986057788999976990699999999972078998999679
Q gi|254780716|r   60 EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        60 ~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
T Consensus       100 ~e---a~~dADilvf~vPh-Qf~~~ic~~l~g~vk~~~~aISL~  139 (372)
T KOG2711         100 VE---AAKDADILVFVVPH-QFIPRICEQLKGYVKPGATAISLI  139 (372)
T ss_pred             HH---HHCCCCEEEEECCH-HHHHHHHHHHHCCCCCCCEEEEEE
T ss_conf             98---84338889994871-547999999854257998078854