HHsearch alignment for GI: 254780716 and conserved domain: PRK00066

>PRK00066 ldh L-lactate dehydrogenase; Reviewed.
Probab=95.91  E-value=0.17  Score=30.50  Aligned_cols=103  Identities=12%  Similarity=0.226  Sum_probs=60.6

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHH---HCCCCCCC-CEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             8805698157111688999997898--59997399899999997---12211278-403289899986057788999976
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIK---KISGLSQK-VIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~---~~~~~~~~-~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
T Consensus         6 ~~KI~IIGaG~VG~~~a~~l~~~~l~~el~LiD~~~~~a~g~a~Dl~h~~~~~~~~~i~~gdy~~----~~daDvVVitA   81 (315)
T PRK00066          6 HNKVVLVGDGAVGSSYAYALVNQGIADELVIIDINKEKAEGDAMDLSHAVPFTSPTKIYAGDYSD----CKDADLVVITA   81 (315)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCHHH----HCCCCEEEECC
T ss_conf             98499999798899999999866998889998089871078999888541236884797399999----67999999899


Q ss_pred             CC----H-----------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             99----0-----------699999999972078998999679865789999
Q gi|254780716|r   77 TD----G-----------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        77 p~----g-----------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
T Consensus        82 G~~~k~g~tR~dll~~N~~I~~~i~~~i~~~-~p~~i~ivvt--NPvDvmt  129 (315)
T PRK00066         82 GAPQKPGETRLDLVEKNLKIFKSIVGEVMAS-GFDGIFLVAS--NPVDILT  129 (315)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC-CCCEEEEEEC--CCHHHHH
T ss_conf             9989999987899987899999988776424-8853999936--9189999