HHsearch alignment for GI: 254780716 and conserved domain: PRK01438

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=96.55  E-value=0.034  Score=35.70  Aligned_cols=114  Identities=14%  Similarity=0.142  Sum_probs=64.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH-----HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--C
Q ss_conf             8056981571116889999978985999739989-----99999971221127840328989998605778899997--6
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--V   76 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~-----~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--v   76 (475)
T Consensus        15 k~v~V~GlG~sG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~l~~~g~----~~~~g~~~~~~~---~~~d~vV~SPGI   87 (481)
T PRK01438         15 LRVVVAGLGVSGFPAADALHELGASVTVVADGDDDRSRERAALLEVLGA----TVRLGDGETTLP---EGTELVVTSPGW   87 (481)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHCCC----EEEECCCHHHHH---CCCCEEEECCCC
T ss_conf             9899995758899999999967998999979987448689998885498----899688756662---489999989978


Q ss_pred             CCHHH-HHHHHH---------HHHH-CC----CCCC-EEEECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             99069-999999---------9972-07----8998-999679865789999999998479943
Q gi|254780716|r   77 TDGDP-VDQLID---------KLKP-LL----SPED-ILLDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        77 p~g~~-v~~vi~---------~l~~-~l----~~g~-iiID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
T Consensus        88 ~~~~p~~~~a~~~gi~i~~eiel~~~~~~~~~~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~  151 (481)
T PRK01438         88 RPTHPLLAAAAEAGIPVWGDVELAWRLRDPDGTPAPWLAVTGTNGKTTTVQMLASILRAAGLRA  151 (481)
T ss_pred             CCCCHHHHHHHHCCCCEECHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             9989999999986993861899999875213688878999389974609999999999669970