HHsearch alignment for GI: 254780716 and conserved domain: PRK01747

>PRK01747 mnmC 5-methylaminomethyl-2-thiouridine methyltransferase; Reviewed.
Probab=95.09  E-value=0.033  Score=35.81  Aligned_cols=34  Identities=32%  Similarity=0.628  Sum_probs=31.3

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             8805698157111688999997898599973998
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
T Consensus       256 ~~~VaVIGAGIAGas~A~~LA~rG~~VtVlDr~~  289 (660)
T PRK01747        256 NRDAAIIGGGIAGAALALALARRGWQVTLYEADE  289 (660)
T ss_pred             CCCEEEECCHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             8718998938999999999997899689994798