HHsearch alignment for GI: 254780716 and conserved domain: PRK02006

>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=96.36  E-value=0.11  Score=32.01  Aligned_cols=121  Identities=14%  Similarity=0.162  Sum_probs=65.4

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECC--HHHHHHHHHHCCCCCCCCE-ECCCHHHHHHHCCCCCEEEEE--C
Q ss_conf             9880569815711168899999789859997399--8999999971221127840-328989998605778899997--6
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKD--FELTDVFIKKISGLSQKVI-VTKNLEQMVEAVCKPRKILMM--V   76 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~--~~~~~~l~~~~~~~~~~~~-~~~s~~e~v~~l~~pr~Iil~--v   76 (475)
T Consensus         6 ~~k~vlV~GlG~sG~a~a~~L~~~G~~V~~~D~~~~~~~~~~l~~~~~~~--~~~~g~~~~-~~---~~~~d~vV~SPGI   79 (501)
T PRK02006          6 QRPMVLVLGLGESGLAMARWCARHGCRLRVADTREAPPNLAALQAEGIDA--EFVGGAFDP-AL---LDGVELVALSPGL   79 (501)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHCCCCC--EEECCCCCH-HH---HCCCCEEEECCEE
T ss_conf             89839998336889999999997898499998999986199998608981--897788986-78---4689999989900


Q ss_pred             C-CHHHHHHHH-----------H------HHHHCCCC-----CCEE-EECCCCCHHHHHHHHHHHHHCCCCEECCC
Q ss_conf             9-906999999-----------9------99720789-----9899-96798657899999999984799430675
Q gi|254780716|r   77 T-DGDPVDQLI-----------D------KLKPLLSP-----EDIL-LDGGNSHFCDTQIRSLQLSEKGIYFIGIG  128 (475)
Q Consensus        77 p-~g~~v~~vi-----------~------~l~~~l~~-----g~ii-ID~sts~~~~t~~~~~~l~~kgi~fid~p  128 (475)
T Consensus        80 ~p~~p~~~~~l~~A~~~gi~i~~eiel~~~~~~~~~~~~~~~~~iIaVTGTnGKTTTt~li~~iL~~~g~~~~~~G  155 (501)
T PRK02006         80 SPLEPALAALLAAARERGIPVWGELELFAQALAALGASRGYAPKVLAITGTNGKTTTTSLTGLLCERAGKKVAVAG  155 (501)
T ss_pred             CCCCCCHHHHHHHHHHCCCCEEEHHHHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             8888543199999998799587689999988763022235687489993899668799999999997699746525