HHsearch alignment for GI: 254780716 and conserved domain: PRK03369

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=97.28  E-value=0.0097  Score=39.75  Aligned_cols=114  Identities=16%  Similarity=0.185  Sum_probs=67.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCHHH
Q ss_conf             805698157111688999997898599973998999999971221127840328989998605778899997--699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g~~   81 (475)
T Consensus        13 k~V~V~GlG~sG~a~a~~L~~~G~~v~~~D~~~~~~~~~~~~~~~~---~~~~~~~----~~~~~~d~vV~SPGI~~~~p   85 (487)
T PRK03369         13 APVLVAGAGVTGRAVLAALTRFGARPTVCDDDPDALRPHAERGVAT---VSSSDAV----QQIADYALVVTSPGFPPTAP   85 (487)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCCE---ECCCCCH----HHHCCCCEEEECCCCCCCCH
T ss_conf             9899991568389999999978697999989825779998659948---6376226----56467788998995799899


Q ss_pred             -HHHHHH---------HHHHCC-------CCCC-EEEECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             -999999---------997207-------8998-999679865789999999998479943
Q gi|254780716|r   82 -VDQLID---------KLKPLL-------SPED-ILLDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        82 -v~~vi~---------~l~~~l-------~~g~-iiID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
T Consensus        86 ~l~~a~~~gi~i~~eieL~~~~~~~~~~~~~~~~IaVTGTnGKTTttsli~~iL~~~g~~~  146 (487)
T PRK03369         86 VLAAAAAAGVPIWGDVELAWRLDAAGCYGPPRRWLVVTGTNGKTTTTSMLHAMLRAAGRRS  146 (487)
T ss_pred             HHHHHHHCCCCEEEHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             9999998899076599999998744433676655999798872789999999998589985