HHsearch alignment for GI: 254780716 and conserved domain: PRK05565

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.
Probab=95.61  E-value=0.14  Score=31.14  Aligned_cols=78  Identities=18%  Similarity=0.390  Sum_probs=54.8

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHH
Q ss_conf             1571116889999978985999-739989999999712211278403289899986057788999976990699999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDK   88 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~   88 (475)
T Consensus        13 gs~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~l~~~~~~~----------------~~~~~Dl~~~~~~~~~~~~   76 (247)
T PRK05565         13 ASGGIGRAIAELLAKEGAKVVIAYDKNEEAANELLEEIKEVGGDA----------------IAVKADVSSEDDVENLVEQ   76 (247)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHHHHHHH
T ss_conf             845899999999998799899981799899999999999639908----------------9998358999999999999


Q ss_pred             HHHCCCCCCEEEECC
Q ss_conf             972078998999679
Q gi|254780716|r   89 LKPLLSPEDILLDGG  103 (475)
Q Consensus        89 l~~~l~~g~iiID~s  103 (475)
T Consensus        77 ~~~~~g~iD~lVnnA   91 (247)
T PRK05565         77 IVEKFGKIDILVNNA   91 (247)
T ss_pred             HHHHCCCCCEEEECC
T ss_conf             999809984999899