HHsearch alignment for GI: 254780716 and conserved domain: PRK05597

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated.
Probab=95.81  E-value=0.14  Score=31.30  Aligned_cols=125  Identities=17%  Similarity=0.231  Sum_probs=77.5

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC--CCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             8805698157111688999997898-59997399899999997122--11278403289899986057788999976990
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS--GLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~--~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
T Consensus        28 ~s~VlvvG~GGLG~~~~~yLa~aGvG~i~i~D~D~ve~sNL~RQ~l~~~~~iG~~K~~~a~~~l~~~n-p~i~i~~~~~~  106 (355)
T PRK05597         28 DAKVSVIGAGGLGSPALLYLAGAGVGHITIIDDDVVDLSNLHRQVIHTTAGVGTPKAESAREAMLALN-PDVKVTVSVRR  106 (355)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHC-CCCCEEEEHHH
T ss_conf             29689987776689999999984997599972999261213377565412179797999999999878-99742753321


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
T Consensus       107 -l~~---~na~~li~~~DvVvD~tD-n~~tR~lind~c~~~~~PlV~ga~~~~~  155 (355)
T PRK05597        107 -LDW---SNALSELADADVILDGSD-NFDTRHVASWAAARLGIPHVWASILGFD  155 (355)
T ss_pred             -CCH---HHHHHHHHCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEECCCCE
T ss_conf             -577---789977528878987678-8889999999999869987996524467