HHsearch alignment for GI: 254780716 and conserved domain: PRK05600

>PRK05600 thiamine biosynthesis protein ThiF; Validated.
Probab=95.68  E-value=0.1  Score=32.29  Aligned_cols=126  Identities=14%  Similarity=0.158  Sum_probs=77.8

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC--CCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             98805698157111688999997898-59997399899999997122--1127840328989998605778899997699
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS--GLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~--~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
T Consensus        40 ~~a~VlvvG~GGLG~p~~~yLaaaGvG~i~ivD~D~Ve~sNL~RQil~~~~diG~~K~~~A~~~l~~lN-p~i~i~~~~~  118 (370)
T PRK05600         40 HNARVLVIGAGGLGCPAMQSLASAGVGTITLIDDDTVDVSNIHRQILFGASDVGRPKVEVAAERLKEIQ-PDIRVNALRE  118 (370)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHCCCHHHCCCCHHHHHHHHHHHHC-CCCCEEEHHH
T ss_conf             619789988875789999999982897489873898260210555426976669757999999999878-9971573566


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             0699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
T Consensus       119 ~-l~~---~n~~~li~~~DvVvD~tD-Nf~tRylindaC~~~~~PlV~ga~~~~e  168 (370)
T PRK05600        119 R-LTA---ENAVELLNGVDLVLDGSD-SFATKFLVADAAEITGTPLVWGTVLRFH  168 (370)
T ss_pred             H-CCH---HHHHHHHHCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEEECCCE
T ss_conf             4-699---999987636878997788-8799999999999849976984532628