HHsearch alignment for GI: 254780716 and conserved domain: PRK05708

>PRK05708 2-dehydropantoate 2-reductase; Provisional.
Probab=98.76  E-value=7e-06  Score=62.88  Aligned_cols=114  Identities=15%  Similarity=0.135  Sum_probs=80.2

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCC---CCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             9988056981571116889999978985999739989999999712211---2784032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGL---SQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~---~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
T Consensus         1 m~M-kI~IiGaGAiG~~~a~~L~~ag~dV~lv~r~~~~~~~~~~~g~~~~~~~~~~~~~~v~~~~~~~~~~~D~vivavK   79 (305)
T PRK05708          1 MSM-TWHILGAGSLGSLWACRLARAGLPVRLILRDRQRLAAYQQAGGLTLVEQGQASLYAIPAETADAPEPIHRLLVACK   79 (305)
T ss_pred             CCC-EEEEECCCHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHCCCEEEEECCCEEEEECCCCCCCCCCCCCEEEEEEC
T ss_conf             998-8999882399999999998489973999947899999997899899868955787404657665788778999804


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             9069999999997207899899967986578999999999
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQL  117 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l  117 (475)
T Consensus        80 ~~-~~~~a~~~l~~~l~~~t~Iv~lQNGl-g~~e~la~~~  117 (305)
T PRK05708         80 AY-DAEPAVASLAHRLAPGAELLLLQNGL-GSQDAVAARV  117 (305)
T ss_pred             CC-CHHHHHHHHHHHCCCCCEEEEECCCC-CHHHHHHHHC
T ss_conf             25-68999999886449995899943776-4799999977