HHsearch alignment for GI: 254780716 and conserved domain: PRK05717

>PRK05717 oxidoreductase; Validated.
Probab=96.08  E-value=0.093  Score=32.51  Aligned_cols=78  Identities=15%  Similarity=0.231  Sum_probs=58.8

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
T Consensus        12 valITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~---~----------------~~~~~~~Dvt~~~~v~   72 (255)
T PRK05717         12 VALVTGAARGIGLGIAAWLIAEGWQVVLADLDRERGAKVAKALG---E----------------NAWFIAMDVADEAQVA   72 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC---C----------------CEEEEEEECCCHHHHH
T ss_conf             89995878889999999999879989999698899999999848---9----------------7589993079999999


Q ss_pred             HHHHHHHHCCCCCCEEEEC
Q ss_conf             9999997207899899967
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~  102 (475)
T Consensus        73 ~~i~~~~~~~G~id~lvnN   91 (255)
T PRK05717         73 AGVAEVLGQFGRLDALVCN   91 (255)
T ss_pred             HHHHHHHHHHCCCCEEEEC
T ss_conf             9999999982999899987