HHsearch alignment for GI: 254780716 and conserved domain: PRK05855

>PRK05855 short chain dehydrogenase; Validated.
Probab=95.65  E-value=0.12  Score=31.57  Aligned_cols=72  Identities=15%  Similarity=0.180  Sum_probs=36.2

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             11688999997898599973998999999971221127840328989998605778899997699069999999997207
Q gi|254780716|r   14 MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLL   93 (475)
Q Consensus        14 MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l   93 (475)
T Consensus       327 IGrA~A~~fA~~GA~Vvl~Dr~~~~l~eta~ei~~~G~~a~----------------~~~~DVtd~~av~al~~~v~~~~  390 (582)
T PRK05855        327 IGRATALAFAREGAEVVASDIDEAAAERTAALIRAAGAVAH----------------AYRVDVSDADAMEALAEWVGAEH  390 (582)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHHHHHHHHHHHHC
T ss_conf             99999999997799999960799999999999995198489----------------99755899999999999999976


Q ss_pred             CCCCEEEE
Q ss_conf             89989996
Q gi|254780716|r   94 SPEDILLD  101 (475)
Q Consensus        94 ~~g~iiID  101 (475)
T Consensus       391 G~iDILVN  398 (582)
T PRK05855        391 GVPDIVVN  398 (582)
T ss_pred             CCCCEEEE
T ss_conf             99999998