HHsearch alignment for GI: 254780716 and conserved domain: PRK06123

>PRK06123 short chain dehydrogenase; Provisional.
Probab=95.62  E-value=0.22  Score=29.69  Aligned_cols=86  Identities=17%  Similarity=0.331  Sum_probs=58.9

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698--1571116889999978985999-7399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
T Consensus         1 m~n-KvalITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dv~   63 (249)
T PRK06123          1 MMR-KVMIITGASRGIGAATALLAAERGYAVCLNYLRNRDAAEAVVQAIRRQGGEAL----------------AVAADVA   63 (249)
T ss_pred             CCC-CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEE----------------EEECCCC
T ss_conf             999-88999686879999999999987998999808987899999999996499099----------------9984799


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             90699999999972078998999679
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
T Consensus        64 ~~~~v~~~~~~~~~~~G~iDiLVnNA   89 (249)
T PRK06123         64 DEADVLRLFEAVDRELGRLDALVNNA   89 (249)
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99999999999999829987899888