HHsearch alignment for GI: 254780716 and conserved domain: PRK06139

>PRK06139 short chain dehydrogenase; Provisional.
Probab=95.95  E-value=0.086  Score=32.77  Aligned_cols=77  Identities=19%  Similarity=0.239  Sum_probs=56.0

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHH
Q ss_conf             57111688999997898599973998999999971221127840328989998605778899997699069999999997
Q gi|254780716|r   11 LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLK   90 (475)
Q Consensus        11 LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~   90 (475)
T Consensus        15 SsGIG~aiA~~~A~~Ga~Vvl~~R~~~~L~~~a~e~~~~G~~~~----------------~v~~DVsd~~~v~~~~~~~~   78 (324)
T PRK06139         15 SSGIGRATAEAFARRGARLVLAARDEEALFEVAEECRALGAEVL----------------VVPTDVTHADQVQALATQAA   78 (324)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHHHHHHHHHH
T ss_conf             54999999999998799899998999999999999995499489----------------99766788578999999999


Q ss_pred             HCCCCCCEEEECC
Q ss_conf             2078998999679
Q gi|254780716|r   91 PLLSPEDILLDGG  103 (475)
Q Consensus        91 ~~l~~g~iiID~s  103 (475)
T Consensus        79 ~~~G~IDiLVNNA   91 (324)
T PRK06139         79 SFLGRIDVWFNNV   91 (324)
T ss_pred             HHCCCCCEEEECC
T ss_conf             9749987886457