HHsearch alignment for GI: 254780716 and conserved domain: PRK06180

>PRK06180 short chain dehydrogenase; Provisional.
Probab=96.39  E-value=0.093  Score=32.52  Aligned_cols=84  Identities=21%  Similarity=0.326  Sum_probs=62.1

Q ss_pred             CCCCEEEEE-EC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             998805698-15-7111688999997898599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGII-GL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiI-GL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
T Consensus         1 M~~~KvvlITGassGIG~aiA~~l~~~G~~Vi~~~R~~~~l~~l~~~~~~---~~----------------~~~~~Dvtd   61 (277)
T PRK06180          1 MASMKTWLITGVSSGFGRALAQAALAAGHRVVGTVRSAAARRDFEALHPG---RA----------------LARVLDVTD   61 (277)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC---CE----------------EEEEEECCC
T ss_conf             99998899917873999999999998799999998999999999986799---57----------------999983799


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
T Consensus        62 ~~~v~~~v~~~~~~~G~iDvLVNNA   86 (277)
T PRK06180         62 FDAIDGVVADAEATVGPIDVLVNNA   86 (277)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999999819986999899