HHsearch alignment for GI: 254780716 and conserved domain: PRK06349

>PRK06349 homoserine dehydrogenase; Provisional.
Probab=96.74  E-value=0.019  Score=37.57  Aligned_cols=167  Identities=19%  Similarity=0.339  Sum_probs=95.3

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHC--------CCE---EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCC
Q ss_conf             9988056981571116889999978--------985---99973998999999971221127840328989998605778
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDK--------GFR---LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKP   69 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~--------G~~---V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~p   69 (475)
T Consensus         1 M~~ikIgl~G~GtVG~gv~~il~~~~~~i~~~~g~~~~i~~i~~r~~~k~r~~------~~~~~~~t~d~~~i~~d~-~i   73 (432)
T PRK06349          1 MKPLKVGLLGLGTVGSGVVRILEENAEEIAARAGRPIEIKKVAVRDLEKDRGV------DLSGYLLTTDPEELVNDP-DI   73 (432)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCC------CCCCCEEECCHHHHHCCC-CC
T ss_conf             95538999987806999999999809999998699769999996897535589------998555547999994389-99


Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCH-HHHHHHHHHHHHCCCC-EECCCCCCCCCCCCCCCEEEEECC
Q ss_conf             89999769906999999999720789989996798657-8999999999847994-306754676000356843788454
Q gi|254780716|r   70 RKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHF-CDTQIRSLQLSEKGIY-FIGIGVSGGVKGARSGASLMVGGN  147 (475)
Q Consensus        70 r~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~-~~t~~~~~~l~~kgi~-fid~pVSGG~~gA~~G~slMvGG~  147 (475)
T Consensus        74 divVEliGG~~~A~~~i~---~AL~~GkhVVTANKallA~~g~eL~~lA~~~gv~l~fEAaV~GGIP-------------  137 (432)
T PRK06349         74 DIVVELMGGIEPARELIL---AALEAGKHVVTANKALLAVHGNELFAAAEEKGVDLYFEAAVAGGIP-------------  137 (432)
T ss_pred             CEEEEECCCCHHHHHHHH---HHHHCCCCEEECCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCH-------------
T ss_conf             899996699507999999---9998599689258799986799999999871964999632246612-------------


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEE-CC-CCHHHHH--HHHHHHHHHHHHHHHHHHH
Q ss_conf             899988899999875015678618985-69-8746789--8877678788899989999
Q gi|254780716|r  148 EKAYNRVENILLSISAKYQNSPCCALL-GP-DGSGHFV--KMIHNGIEYANMQLIADIY  202 (475)
Q Consensus       148 ~~~~~~~~piL~~iaak~~~~~cv~y~-G~-~GsGh~v--KMVhNgIey~~mq~iaE~~  202 (475)
T Consensus       138 -----iI~~l~~~l~~~~-----i~~i~GIlNGTtNyILt~M~~~g~~f~~--aL~eAQ  184 (432)
T PRK06349        138 -----IIKALREGLAANR-----ITRVMGIVNGTTNYILTKMTEEGLSFED--ALKEAQ  184 (432)
T ss_pred             -----HHHHHHHHHHCCC-----CEEEEEEECCCHHHHHHHHHHCCCCHHH--HHHHHH
T ss_conf             -----0699987640477-----4377676247367999999871999999--999999