HHsearch alignment for GI: 254780716 and conserved domain: PRK06476

>PRK06476 pyrroline-5-carboxylate reductase; Reviewed.
Probab=98.99  E-value=1.9e-06  Score=67.07  Aligned_cols=141  Identities=13%  Similarity=0.248  Sum_probs=92.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC---EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698157111688999997898---599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF---RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~---~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
T Consensus         2 kIgfIG~GnMg~Aii~Gl~~~~~~~~~i~v~~r~~~~~~~l~~~~~----~v~~~~~n~~~~~~~---dvi~LaVKP-~~   73 (255)
T PRK06476          2 RIGFIGTGAITEAMVTGLLSSPADVSEIIVSPRNAQIAARLAARFA----KVRIAKDNQAVVDRS---DVVFLAVRP-QI   73 (255)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHCC----CEEEECCHHHHHHHC---CEEEEEECH-HH
T ss_conf             8999864699999999999788992508898989899999998769----559857889998518---878886178-88


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC-EECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             999999997207899899967986578999999999847994-3067546760003568437884548999888999998
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY-FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLS  160 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~-fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~  160 (475)
T Consensus        74 ~~~vl~~l~--~~~~~~vISi~AGi--~i~~l~~~l~~-~~~vvR~MPN--~~~~~g~g~t~i~~~~----~~v~~lf~~  142 (255)
T PRK06476         74 AEEVLRALR--FRPGQTVISVIAAT--TRAALLKWIGA-DVKLVRAIPL--PFVAERKGVTAIYPPD----PFVRALFDA  142 (255)
T ss_pred             HHHHHHHHH--CCCCCEEEEECCCC--CHHHHHHHHCC-CCCEEEECCC--CHHHHCCCCEEECCCH----HHHHHHHHH
T ss_conf             998877620--57897899973787--79999976189-9864885587--0888468862214867----999999983


Q ss_pred             HHCC
Q ss_conf             7501
Q gi|254780716|r  161 ISAK  164 (475)
Q Consensus       161 iaak  164 (475)
T Consensus       143 ~G~~  146 (255)
T PRK06476        143 LGTA  146 (255)
T ss_pred             CCCE
T ss_conf             8998