HHsearch alignment for GI: 254780716 and conserved domain: PRK06500

>PRK06500 short chain dehydrogenase; Provisional.
Probab=95.40  E-value=0.26  Score=29.18  Aligned_cols=75  Identities=13%  Similarity=0.099  Sum_probs=54.4

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
T Consensus        14 as~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~---~~----------------~~~~~Dv~~~~~~~~~~~~~   74 (249)
T PRK06500         14 GTSGIGLETARQFAAEGARVAITGRDAATLEAARAELGE---DA----------------LVIRNDAGSVAAQRALAQAL   74 (249)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC---CE----------------EEEEEECCCHHHHHHHHHHH
T ss_conf             687899999999998799999996998999999998589---75----------------99995179999999999999


Q ss_pred             HHCCCCCCEEEECC
Q ss_conf             72078998999679
Q gi|254780716|r   90 KPLLSPEDILLDGG  103 (475)
Q Consensus        90 ~~~l~~g~iiID~s  103 (475)
T Consensus        75 ~~~~g~iDiLvnnA   88 (249)
T PRK06500         75 AEAGGRLDAVFINA   88 (249)
T ss_pred             HHHCCCCCEEEECC
T ss_conf             99769998999899