HHsearch alignment for GI: 254780716 and conserved domain: PRK06522

>PRK06522 2-dehydropantoate 2-reductase; Reviewed.
Probab=99.05  E-value=3.6e-07  Score=72.43  Aligned_cols=97  Identities=19%  Similarity=0.298  Sum_probs=76.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC-------CCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             0569815711168899999789859997399899999997122112-------784032898999860577889999769
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLS-------QKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~-------~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
T Consensus         2 kI~IiGaGaiG~~~a~~L~~ag~~V~li~r~~~~~~~i~~~Gl~i~~~~~~~~~~~~~~~~~~----~~~~~D~iiv~vK   77 (307)
T PRK06522          2 KIAILGAGAIGGLFGARLAQAGHDVTLVARGATLAEALNENGLRLLEGGEVFVVPVPAADDPA----ELGPQDLVILAVK   77 (307)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCEEEECCCCEEECCCCCCCCHH----HCCCCCEEEEECC
T ss_conf             899999149999999999848998899978888999999689399528976980550348866----7489888999806


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             90699999999972078998999679865
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
T Consensus        78 s-~~~~~a~~~l~~~l~~~t~iv~lqNG~  105 (307)
T PRK06522         78 A-YQLPAALPDLAPLLGPETVVLFLQNGV  105 (307)
T ss_pred             C-CCHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             6-689999999986459994899961686