HHsearch alignment for GI: 254780716 and conserved domain: PRK06940

>PRK06940 short chain dehydrogenase; Provisional.
Probab=95.38  E-value=0.27  Score=29.13  Aligned_cols=85  Identities=16%  Similarity=0.244  Sum_probs=55.1

Q ss_pred             CCCCEEEEE-ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             998805698-1571116889999978985999739989999999712211278403289899986057788999976990
Q gi|254780716|r    1 MKQADIGII-GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         1 M~k~~IGiI-GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
T Consensus         3 L~~-kV~v~tGa~GIG~aiA~~la-~Ga~vvi~~~~~~~l~~~~~~l~~~g~~~~----------------~~~~Dvs~~   64 (277)
T PRK06940          3 MSK-EVVVVIGAGGMGQAIARRVG-SGKTVLLADYNEENLQAVARTLREAGFDVI----------------TQQVDVSSR   64 (277)
T ss_pred             CCC-CEEEECCCCHHHHHHHHHHH-HCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCH
T ss_conf             899-29999781699999999998-199899998988999999999872288299----------------998257998


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             6999999999720789989996798
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGN  104 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~st  104 (475)
T Consensus        65 ~~v~~l~~~~-~~~G~idiLVnnAG   88 (277)
T PRK06940         65 ESVKALAQTA-ATLGAVTGLVHTAG   88 (277)
T ss_pred             HHHHHHHHHH-HHHCCCCEEEECCC
T ss_conf             9999999999-98699879998886