HHsearch alignment for GI: 254780716 and conserved domain: PRK06947

>PRK06947 glucose-1-dehydrogenase; Provisional.
Probab=95.45  E-value=0.16  Score=30.82  Aligned_cols=83  Identities=12%  Similarity=0.245  Sum_probs=57.2

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698--1571116889999978985999-73998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
T Consensus         7 KvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dvs~~~~   70 (252)
T PRK06947          7 KVVLITGASRGIGRATAVLAAARGWSVGINYARDAAAAEETADAVRAAGGRAC----------------VVAGDVANEAD   70 (252)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHH
T ss_conf             08999388358999999999987998999808987899999999996499289----------------99847999999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECC
Q ss_conf             9999999972078998999679
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~s  103 (475)
T Consensus        71 v~~~~~~~~~~~G~iD~lVnNA   92 (252)
T PRK06947         71 VIAMFDAVQAAFGRLDALVNNA   92 (252)
T ss_pred             HHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999849988999876