HHsearch alignment for GI: 254780716 and conserved domain: PRK07236

>PRK07236 hypothetical protein; Provisional.
Probab=94.59  E-value=0.05  Score=34.49  Aligned_cols=37  Identities=14%  Similarity=0.185  Sum_probs=34.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9988056981571116889999978985999739989
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
T Consensus         4 ~~~~kV~IVGaGiaGL~~A~~L~~~G~~v~v~Er~~~   40 (386)
T PRK07236          4 MSKPRAVVVGGSLGGLFAANLLRRAGWDVDVFERSPT   40 (386)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             9999689999368999999999858999899868998