HHsearch alignment for GI: 254780716 and conserved domain: PRK07326

>PRK07326 short chain dehydrogenase; Provisional.
Probab=95.76  E-value=0.11  Score=31.91  Aligned_cols=80  Identities=19%  Similarity=0.285  Sum_probs=58.1

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
T Consensus         7 valITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~--~~----------------~~~~~Dv~d~~~v~   68 (235)
T PRK07326          7 AALVTGGSKGIGFAVAEALAAAGYRVAICARDESELEAAAQELGKR--NV----------------LGLACDVRDEADVR   68 (235)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCC--CE----------------EEEEEECCCHHHHH
T ss_conf             9999382679999999999987999999989889999999984239--86----------------99996389999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
T Consensus        69 ~~v~~~~~~~G~iDiLVNNA   88 (235)
T PRK07326         69 QAVDAHVEAFGGLDILVNNA   88 (235)
T ss_pred             HHHHHHHHHCCCCEEEEECC
T ss_conf             99999999829966999888