HHsearch alignment for GI: 254780716 and conserved domain: PRK07502

>PRK07502 cyclohexadienyl dehydrogenase; Validated.
Probab=99.42  E-value=6.1e-11  Score=100.22  Aligned_cols=158  Identities=20%  Similarity=0.270  Sum_probs=118.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698157111688999997898--5999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
T Consensus         8 ~I~IiGlGLIGgSlA~alk~~~~~~~I~g~d~~~~~l~~A~~~g~id----~~~~~~~e~---~~~~DlIilatPv~-~~   79 (307)
T PRK07502          8 RVALIGLGLIGSSLARAIRRQGLAGEIVGAARSAETRARARELGLGD----RVTTSAAEA---VKGADLVILCVPVG-AS   79 (307)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCC----HHCCCHHHH---HCCCCEEEEECCHH-HH
T ss_conf             68999278799999999985499857999849999999999869975----112777664---04589799917899-99


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCC----CC----CCC-CEEEE---ECCHH
Q ss_conf             999999972078998999679865789999999998479943067-5467600----03----568-43788---45489
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVK----GA----RSG-ASLMV---GGNEK  149 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~----gA----~~G-~slMv---GG~~~  149 (475)
T Consensus        80 ~~vl~~l~~~l~~~~ivTDvgSvK~~I~~~~-~~~~~~~~~FVg~HPmAGsE~sG~~~A~~~LF~~~~~iltp~~~~~~~  158 (307)
T PRK07502         80 GAVAAEIAPHLKPGAIVTDVGSVKASVIAAM-APHLPEGVHFIPGHPLAGTEHSGPDAGFAELFENRWCILTPPEGTDPA  158 (307)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCHHHHHHHH-HHHCCCCCCEECCCCCCCCCCCCCCHHHHHHHCCCEEEEECCCCCCHH
T ss_conf             9999999855589968996632118999999-985677783672688767887551010014743870899679999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCC
Q ss_conf             9988899999875015678618985698
Q gi|254780716|r  150 AYNRVENILLSISAKYQNSPCCALLGPD  177 (475)
Q Consensus       150 ~~~~~~piL~~iaak~~~~~cv~y~G~~  177 (475)
T Consensus       159 ~~~~v~~lw~~lGa~------v~~m~~~  180 (307)
T PRK07502        159 AVARLRAFWRALGAR------VEEMDPE  180 (307)
T ss_pred             HHHHHHHHHHHCCCE------EEEECHH
T ss_conf             999999999963987------9994645