HHsearch alignment for GI: 254780716 and conserved domain: PRK07660

>PRK07660 consensus.
Probab=98.99  E-value=2.9e-07  Score=73.12  Aligned_cols=194  Identities=20%  Similarity=0.235  Sum_probs=125.1

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC------------------CCCCCEECCCHHHH
Q ss_conf             998805698157111688999997898599973998999999971221------------------12784032898999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG------------------LSQKVIVTKNLEQM   62 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~------------------~~~~~~~~~s~~e~   62 (475)
T Consensus         1 M~Ik~VaViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~~~~--   78 (283)
T PRK07660          1 MGVQKIVVIGAGQMGSGIAQVCAMAGYDVKVQDLKQEQLDRGLAIITKNLARQVEKGRMKEEEKEATLNRLTVTLDLD--   78 (283)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCHH--
T ss_conf             997889998969899999999996698189997988999999999999999998705899899999983587768989--


Q ss_pred             HHHCCCCCEEEEECCCHHHHHHH-HHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCC-CCCCCCC
Q ss_conf             86057788999976990699999-9999720789989996798657899999999984----7994306754-6760003
Q gi|254780716|r   63 VEAVCKPRKILMMVTDGDPVDQL-IDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGV-SGGVKGA  136 (475)
Q Consensus        63 v~~l~~pr~Iil~vp~g~~v~~v-i~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pV-SGG~~gA  136 (475)
T Consensus        79 --~~~~aDlViEav~E~l~iK~~lf~~l~~~~~~~~I-laSNTS~l~i~~-ia~~~~~p~R~ig~HffnP~~~m~LVE--  152 (283)
T PRK07660         79 --CVKEADLIIEAAVEKMDIKKKIFANLDEIAPEHAI-LATNTSSLPITE-IAAVTKRPEKVIGMHFMNPVPVMKLVE--  152 (283)
T ss_pred             --HHCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCE-EEECCCCCCCHH-HHHHCCCCHHCCCCCCCCCCCCCCEEE--
T ss_conf             --97689999987857544429999999964799718-986588887325-566517824304666678856572154--


Q ss_pred             CCCCEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             568437884--548999888999998750156786189856987467898877678788899989999999964289978
Q gi|254780716|r  137 RSGASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPL  214 (475)
Q Consensus       137 ~~G~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~  214 (475)
T Consensus       153 -----Iv~g~~T~~~~~~~~~~~~~~lgk~------pV~v~-d~pGF----i~NRl~---~~~~~ea~~lv~eG-va~~e  212 (283)
T PRK07660        153 -----IIRGLATDDAVYETIEDITKKIGKV------PVEVN-DFPGF----VSNRIL---LPMINEAIYTLYEG-VATKE  212 (283)
T ss_pred             -----ECCCCCCCHHHHHHHHHHHHHCCCE------EEEEC-CCCCC----HHHHHH---HHHHHHHHHHHHCC-CCCHH
T ss_conf             -----5699999799999999999875942------79983-78973----279878---99999999999819-99999


Q ss_pred             HHHHHHHH
Q ss_conf             99999986
Q gi|254780716|r  215 EISHLFSK  222 (475)
Q Consensus       215 ~i~~vf~~  222 (475)
T Consensus       213 ~iD~~~~~  220 (283)
T PRK07660        213 AIDEVMKL  220 (283)
T ss_pred             HHHHHHHH
T ss_conf             99998675