HHsearch alignment for GI: 254780716 and conserved domain: PRK07819

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated.
Probab=98.77  E-value=3.7e-06  Score=64.95  Aligned_cols=192  Identities=16%  Similarity=0.192  Sum_probs=120.5

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-----------CCC-------CCCCCEECCCHHHHHHH
Q ss_conf             805698157111688999997898599973998999999971-----------221-------12784032898999860
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK-----------ISG-------LSQKVIVTKNLEQMVEA   65 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~-----------~~~-------~~~~~~~~~s~~e~v~~   65 (475)
T Consensus         3 ~kV~ViGaG~mG~~IA~~~a~~G~~V~l~D~~~~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~dl~~----   78 (284)
T PRK07819          3 QRVGVVGAGQMGSGIAEVCARAGVDVLVFETTEEAATAGRNRIEKSLERAVSAGKLTERERDAALARLTFTTDLED----   78 (284)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCHHH----
T ss_conf             6799989778999999999957990899979889999999999999999987278987999999963706689999----


Q ss_pred             CCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH----HCCCCEECCCCCCCCCCCCCCC
Q ss_conf             577889999769906999999-99972078998999679865789999999998----4799430675467600035684
Q gi|254780716|r   66 VCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS----EKGIYFIGIGVSGGVKGARSGA  140 (475)
Q Consensus        66 l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~----~kgi~fid~pVSGG~~gA~~G~  140 (475)
T Consensus        79 ~~~adlViEav~E~l~~K~~l~~~ld~~~~~p~~IlaSNTS~l~is~-la~~~~~p~R~ig~HffnP~~~--------~~  149 (284)
T PRK07819         79 LADRQLVIEAVVEDEAVKTEIFAELDKVVTDPDAVLASNTSSIPIMK-LAAATKRPGRVLGLHFFNPVPV--------LP  149 (284)
T ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHH-HHHCCCCHHHHCCCCCCCCCCC--------CE
T ss_conf             76599999907387888899999999742899859996588876134-4411588777115642478322--------12


Q ss_pred             E--EEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             3--7884--54899988899999875015678618985698746789887767878889998999999996428997899
Q gi|254780716|r  141 S--LMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEI  216 (475)
Q Consensus       141 s--lMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i  216 (475)
T Consensus       150 LVEIv~g~~Ts~~~~~~~~~~~~~~l~k~-----~v~~~d~-pGF----i~NRl~~---~~~~ea~~l~~eG-va~~edI  215 (284)
T PRK07819        150 LVELVPTLVTSEATVARAEEFATEVLGKQ-----VVRCQDR-SGF----VVNALLV---PYLLSAIRMVESG-FATAEDI  215 (284)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCC-----CEEECCC-CCC----HHHHHHH---HHHHHHHHHHHCC-CCCHHHH
T ss_conf             57771799998999999999999826966-----3686677-774----1999999---9999999999838-9999999


Q ss_pred             HHHHHH
Q ss_conf             999986
Q gi|254780716|r  217 SHLFSK  222 (475)
Q Consensus       217 ~~vf~~  222 (475)
T Consensus       216 D~~~~~  221 (284)
T PRK07819        216 DKAMVL  221 (284)
T ss_pred             HHHHHH
T ss_conf             999876