HHsearch alignment for GI: 254780716 and conserved domain: PRK08013

>PRK08013 hypothetical protein; Provisional.
Probab=91.67  E-value=0.28  Score=29.00  Aligned_cols=36  Identities=28%  Similarity=0.557  Sum_probs=34.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             998805698157111688999997898599973998
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
T Consensus         1 M~~~DV~IvGaGpvGl~lA~~La~~G~~v~viE~~~   36 (400)
T PRK08013          1 MQSVDVAIVGGGMVGLAVACGLQGSGLRVAVLEHRV   36 (400)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             996788999935999999999971899589991899