HHsearch alignment for GI: 254780716 and conserved domain: PRK08177

>PRK08177 short chain dehydrogenase; Provisional.
Probab=92.60  E-value=0.9  Score=25.24  Aligned_cols=39  Identities=18%  Similarity=0.308  Sum_probs=30.3

Q ss_pred             EEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
Q ss_conf             569815-711168899999789859997399899999997
Q gi|254780716|r    6 IGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIK   44 (475)
Q Consensus         6 IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~   44 (475)
T Consensus         4 ~lITGas~GIG~aia~~l~~~G~~V~~~~R~~~~~~~~~~   43 (225)
T PRK08177          4 ALIIGASRGLGLGLVDRLLERGWQVTATVRGPQQDTALQA   43 (225)
T ss_pred             EEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             9992734299999999999886999999798877899872