HHsearch alignment for GI: 254780716 and conserved domain: PRK08223

>PRK08223 hypothetical protein; Validated.
Probab=96.48  E-value=0.026  Score=36.62  Aligned_cols=137  Identities=15%  Similarity=0.162  Sum_probs=80.7

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHC-CCCC-CCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             988056981571116889999978985-999739989999999712-2112-7840328989998605778899997699
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFR-LAVYNKDFELTDVFIKKI-SGLS-QKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~-V~vydr~~~~~~~l~~~~-~~~~-~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
T Consensus        26 ~~s~VlVvG~GGlGs~~a~~LAraGVG~i~lvD~D~velSNLnRQi~~~~~diG~~Kveva~e~l~~IN-P~v~V~~~~~  104 (287)
T PRK08223         26 RNSRVAIAGLGGVGGVHLLTLARLGIGKFNIADFDVFELVNSNRQYGAMMSSNGRPKVEVMREIALDIN-PELEIRAFPE  104 (287)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHCCCHHHCCCCHHHHHHHHHHHHC-CCCEEEEECC
T ss_conf             559689993675579999999982897599974998463440222344743449858999999999869-8987999587


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH-HHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECC
Q ss_conf             06999999999720789989996798657899999-999984799430675467600035684-3788454
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIR-SLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGN  147 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~-~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~  147 (475)
T Consensus       105 ~-lt~~N~~~~l---~~~DvVvDg~DnF~~~tR~ll~~ac~~~giP~v~~a~l~f~g----q~~vF~P~g~  167 (287)
T PRK08223        105 G-IGKENLDTFL---DGVDVYVDGLDFFVFDIRRLLFREAQARGIPALTAAPLGFST----AWLVFDPGGM  167 (287)
T ss_pred             C-CCHHHHHHHH---HCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCC----EEEEECCCCC
T ss_conf             8-9989999998---679999979667883189999999998599849831541030----6999889997