HHsearch alignment for GI: 254780716 and conserved domain: PRK08306

>PRK08306 dipicolinate synthase subunit A; Reviewed.
Probab=97.92  E-value=0.00032  Score=50.63  Aligned_cols=246  Identities=19%  Similarity=0.159  Sum_probs=124.2

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH--
Q ss_conf             805698157111688999997898599973998999999971221127840328989998605778899997699069--
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP--   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~--   81 (475)
T Consensus         3 ~~iaviGGD~Rq~~l~~~L~~~g~~V~~~gf~~~~---------~~~~~~~~~~~~~~~~~~---~d~iIlPvpg~~d~g   70 (296)
T PRK08306          3 MHIAVIGGDARQLELIRKLVELGAKVSLVGFDQLD---------HGFTGVAKCSSLEEALSD---VDVIILPVPGTNDEG   70 (296)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCC---------CCCCCEEEECCHHHHHHC---CCEEEECCCCCCCCC
T ss_conf             48999787589999999999779979998357655---------566761773467888723---999997883225896


Q ss_pred             -HHH-------HH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC------------CCCCC-CCC----
Q ss_conf             -999-------99-99972078998999679865789999999998479943067------------54676-000----
Q gi|254780716|r   82 -VDQ-------LI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI------------GVSGG-VKG----  135 (475)
Q Consensus        82 -v~~-------vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~------------pVSGG-~~g----  135 (475)
T Consensus        71 ~i~~~~~~~~~~l~~~~~~~l~~~~~vf~G~-~~~----~l~~~~~~~~~~~~d~~e~d~vAi~NaipTAEGai~~ai~~  145 (296)
T PRK08306         71 EVDTVFSNEKLVLTKELLEKTPEHCTIFSGI-ANP----YLKELAETTGRKLIELFERDDVAIYNSIPTAEGAIMMAIEH  145 (296)
T ss_pred             EEECCCCCCCCCHHHHHHHHCCCCCEEEEEC-CCH----HHHHHHHHCCCCEEEEECCCHHHHHCCCCCHHHHHHHHHHC
T ss_conf             3855346787632299997469998799955-998----99999997598367620020355562701489999999965


Q ss_pred             ---CCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             ---35684378845489998889999987501567861898569874678988776787888999899999999642899
Q gi|254780716|r  136 ---ARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKN  212 (475)
Q Consensus       136 ---A~~G~slMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~  212 (475)
T Consensus       146 tp~ti~gs~~lVlG~Gr~G~~lA~~l~~lGA~V-------~V~aR~~~~~----------------a~a~~~G~~--~v~  200 (296)
T PRK08306        146 TPITIHGSNVLVLGFGRTGMTLARTLKALGAKV-------KVGARKSAHL----------------ARITEMGYS--PVH  200 (296)
T ss_pred             CCCCCCCCCEEEECCCHHHHHHHHHHHHCCCEE-------EEEECCHHHH----------------HHHHHCCCE--EEE
T ss_conf             996324765899898689999999999779969-------9997999999----------------999976985--871


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCC-CCHHHHHHHH-------HHHH-CCCCCHHH
Q ss_conf             7899999986068844307999999999740567999520010233365-8716778988-------7751-78885146
Q gi|254780716|r  213 PLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQ-KGTGIRSIIE-------GHKL-SSSMTITE  283 (475)
Q Consensus       213 ~~~i~~vf~~w~~~~~~syLl~i~~~il~~k~~~~g~~lid~i~d~~~~-kgTg~Wt~~~-------a~~l-gvp~p~i~  283 (475)
T Consensus       201 ~~~L~~~~~~~D~i~NTIPa~Vlt~~~l~~~~~--~a----vIIDLAS~PGG~Df~~A~~~Gika~lapgLPGk~APkTa  274 (296)
T PRK08306        201 LSELAEEVGEADIIFNTIPALVLTKNVLSKMPP--HA----LIIDLASKPGGTDFEYAKKLGIKALLAPGLPGKVAPKTA  274 (296)
T ss_pred             HHHHHHHHCCCCEEEECCCHHHCCHHHHHCCCC--CC----EEEEECCCCCCCCHHHHHHHCCEEEECCCCCCCCCHHHH
T ss_conf             999997735699999898525439999941899--96----999947799973889999839859972899973171539


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             77788877500577
Q gi|254780716|r  284 TAIFARNLSLYRDE  297 (475)
Q Consensus       284 ~av~aR~~S~~k~~  297 (475)
T Consensus       275 g~Ila~~i~~ll~e  288 (296)
T PRK08306        275 GQILANVLSNLLAE  288 (296)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999