HHsearch alignment for GI: 254780716 and conserved domain: PRK08324

>PRK08324 short chain dehydrogenase; Validated.
Probab=95.43  E-value=0.2  Score=30.10  Aligned_cols=51  Identities=8%  Similarity=0.163  Sum_probs=27.2

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCHHHCCC-CCCCCCHHHHHHHHHHHHCCCCCHH
Q ss_conf             430799999999974056799952001023-3365871677898877517888514
Q gi|254780716|r  228 LSSYLIKITAEILSSSDTITGMPIIDVICD-KASQKGTGIRSIIEGHKLSSSMTIT  282 (475)
Q Consensus       228 ~~syLl~i~~~il~~k~~~~g~~lid~i~d-~~~~kgTg~Wt~~~a~~lgvp~p~i  282 (475)
T Consensus       400 ~EYW~LEqaK--L~~~~~--~~~L~GKVALVTGga~GIG~A~A~~fa~eGA~Vvl~  451 (676)
T PRK08324        400 IEYWSLEQAK--LQKMPK--PKPLAGKVALVTGAAGGIGLATAKRLAAEGACVVLA  451 (676)
T ss_pred             CCCCHHHHHH--HHCCCC--CCCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEE
T ss_conf             5655177888--626899--988899879994798816299999999879989999