HHsearch alignment for GI: 254780716 and conserved domain: PRK08618

>PRK08618 ornithine cyclodeaminase; Validated.
Probab=97.54  E-value=0.00082  Score=47.64  Aligned_cols=114  Identities=16%  Similarity=0.220  Sum_probs=79.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHH-C-CCEEEEEECCHHHHHHHHHHCCC-CCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698157111688999997-8-98599973998999999971221-12784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD-K-GFRLAVYNKDFELTDVFIKKISG-LSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~-~-G~~V~vydr~~~~~~~l~~~~~~-~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
T Consensus       128 ~~l~iiGaG~QA~~~~~a~~~v~~i~~v~v~~r~~~~~~~f~~~~~~~~g~~v~~~~~~~~av~~aD---iV~taT~s~~  204 (325)
T PRK08618        128 KTLCLIGTGGQAKGQLEAVLAVRDIEKVRVYSRTFEKAYAFAQEIQSKFNTEIYVVESADEAIEEAD---IIVTVTNAKT  204 (325)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHCC---EEEEECCCCC
T ss_conf             5699975607999999999860896689999479999999999998750996699589999984398---8999259998


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHH-HHHHCCCCEECC
Q ss_conf             99999999972078998999679865789999999-998479943067
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL-QLSEKGIYFIGI  127 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~-~l~~kgi~fid~  127 (475)
T Consensus       205 Pv---~~~---~l~~g~hi~aiGs~~p~-~~El~~~~l~~a~~vvvD~  245 (325)
T PRK08618        205 PV---FSE---KLKKGVHINAVGSFRPD-MQEIPSEAIARADKVVVES  245 (325)
T ss_pred             CC---CCC---CCCCCEEECCCCCCCCC-CCCCCHHHHHHCCEEEECC
T ss_conf             64---454---35887175132468986-3457899995199899987