HHsearch alignment for GI: 254780716 and conserved domain: PRK08644

>PRK08644 thiamine biosynthesis protein ThiF; Provisional.
Probab=96.39  E-value=0.029  Score=36.24  Aligned_cols=120  Identities=17%  Similarity=0.226  Sum_probs=69.5

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCC-CCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             98805698157111688999997898-5999739989999999712211-278403289899986057788999976990
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGL-SQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~-~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
T Consensus        26 ~~s~VlivG~GGLG~~~a~~La~aGVG~i~lvD~D~Ve~SNL~RQ~~~~~diG~~Ka~~a~~~l~~iN-p~v~I~~~~~~  104 (209)
T PRK08644         26 KKAKVGIAGAGGLGSNIAVALARSGVGNLKLVDFDVVEPSNLNRQQYFISQIGMFKVEALKENLLRIN-PFVKIEVHQVK  104 (209)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCEECCCCCCCCCCCHHHCCCCHHHHHHHHHHHHC-CCEEEEEEECC
T ss_conf             62968998887889999999999389818998899901541103756787759756999999987448-98289997224


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH-HCCCCEECC
Q ss_conf             699999999972078998999679865789999999998-479943067
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS-EKGIYFIGI  127 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~-~kgi~fid~  127 (475)
T Consensus       105 -l~~~n~~~l---~~~~DiViDctDN-~~tR~li~~~c~~~~~~plV~a  148 (209)
T PRK08644        105 -IDEDNIEEL---FKDCDIVVEAFDN-AETKAMLVETVLEKKGKKVVSA  148 (209)
T ss_pred             -CCHHHHHHH---HHCCCEEEECCCC-HHHHHHHHHHHHHHCCCCEEEE
T ss_conf             -898999999---8579999999999-9999999999999779968999