HHsearch alignment for GI: 254780716 and conserved domain: PRK09126

>PRK09126 hypothetical protein; Provisional.
Probab=93.11  E-value=0.15  Score=31.01  Aligned_cols=37  Identities=19%  Similarity=0.443  Sum_probs=34.7

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9988056981571116889999978985999739989
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
T Consensus         1 Mm~~DV~IvGaGp~Gl~lA~~La~~G~~v~viE~~~~   37 (392)
T PRK09126          1 MMHSDILVVGAGPAGLSFARSLAGSGLKVTLIERQPL   37 (392)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9989999999258999999999868998999908985